GLP-2, human

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	G16006
M.F/Formula	C165H254N44O55S1
M.W/Mr.	3766.2
Sequence	ADGSFSDEMNTILDNLAARDFINWLIQTKITD

CAT#	Product Name	Inquiry
G05006	[Des - His1, Glu9] - Glucagon (1 - 29), amide	Inquiry
G16021	GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat)	Inquiry
10-101-158	Albiglutide	Inquiry
G16007	Glucagon-Like Peptide II, rat	Inquiry
G16001	Glucagon - Like Peptide 1, GLP - 1 (7 - 17) - Cys	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Second-generation Antagonist, GR 82334

GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...

Function of Kassinin in Stimulating Ion Transport in Skin

Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...

Function of romurtide in anti-leukocyte

Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...

KAI-1678: A novel PKC-epsilon inhibitor

KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...

Very Late Antigen-4 blocker-BIO 1211

BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: