Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

GLP-2, human

[Price Inquiry]
CAT#
G16006
Sequence
ADGSFSDEMNTILDNLAARDFINWLIQTKITD
M.W/Mr.
3766.2
Molecular Formula
C165H254N44O55S1
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.