Home > Product > Catalog Peptides > Others > Glu20-salmon calcitonin

Others

Glu20-salmon calcitonin

Price Inquiry
CAT#
C06011
Sequence
CSNLSTCVLGKLSQELHKLETYPRTNTGSGTP-NH2
M.W/Mr.
3432.9
Molecular Formula
C145H239N43O49S2
Length
32

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.