Home > Product > Catalog Peptides > Others > Glu20-salmon calcitonin

Others

Glu20-salmon calcitonin

[Price Inquiry]
CAT#
C06011
Sequence
CSNLSTCVLGKLSQELHKLETYPRTNTGSGTP-NH2
M.W/Mr.
3432.9
Molecular Formula
C145H239N43O49S2
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.