Home > Product > Catalog Peptides > Others > (Glu8.9)-Helodermin

Others

(Glu8.9)-Helodermin

[Price Inquiry]
CAT#
H01002
Sequence
HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP-NH2
M.W/Mr.
3845.46
Molecular Formula
C176H283N45O51
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.