Home > Product > Catalog Peptides > Others > (Glu8.9)-Helodermin

Others

(Glu8.9)-Helodermin

Price Inquiry
CAT#
H01002
Sequence
HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP-NH2
M.W/Mr.
3845.46
Molecular Formula
C176H283N45O51
Length
35

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.