Home > Product > Catalog Peptides > Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2) > Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human

Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human

[Price Inquiry]
CAT#
G16002
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
M.W/Mr.
3297.7
Length
30
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.