Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	G16002
M.W/Mr.	3297.7
Sequence	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

CAT#	Product Name	Inquiry
G16013	(Des-Thr5)-Glucagon	Inquiry
G16005	Glucagon - Like Peptide 1, GLP - 1 (7 - 37)	Inquiry
10-101-16	Exenatide	Inquiry
10-101-59	Liraglutide	Inquiry
CAD-111	GLP-1(7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

What is TB 500?

Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...

Gap 19: Specifically block Cx43 hemichannels inhibitor

Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...

Function of BIM 189 As An Antagonist

BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...

The mechanism and function of acetyl tetrapeptide-2 in human skin

Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...

Effects of tripeptide-3 in skin

Neurotransmitter Inhibitor Peptides Peptides used in topical anti-aging products have multiple applications. Gorouhi and Maib ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: