Home > Product > Catalog Peptides > Others > Glucagon - Like Peptide 1, GLP - 1 (7 - 37)

Others

warning All products are for research use only. Not for human use.

Glucagon - Like Peptide 1, GLP - 1 (7 - 37)

[Price Inquiry]
CAT#
G16005
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
M.W/Mr.
3355.7
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.