Home > Product > Catalog Peptides > Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2) > Glucagon - Like Peptide 1, GLP - 1 (7 - 37)

Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

Glucagon - Like Peptide 1, GLP - 1 (7 - 37)

[Price Inquiry]
CAT#
G16005
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
M.W/Mr.
3355.7
Length
31
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.