Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

Glucagon-Like Peptide II, rat

Price Inquiry
CAT#
G16007
Sequence
ADGSFSDEMNTILDNLATRDFINWLIQTKITD
M.W/Mr.
3796.2
Molecular Formula
C166H256N44O56S1
Length
32

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.