Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

Glucagon-Like Peptide II, rat

[Price Inquiry]
CAT#
G16007
Sequence
ADGSFSDEMNTILDNLATRDFINWLIQTKITD
M.W/Mr.
3796.2
Molecular Formula
C166H256N44O56S1
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.