Home > Product > Catalog Peptides > β-Amyloid Mutations > [Gly22]-beta-Amyloid (1-40), Arctic Mutation

β-Amyloid Mutations

[Gly22]-beta-Amyloid (1-40), Arctic Mutation

[Price Inquiry]
CAT#
A13255
Sequence
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
M.W/Mr.
4257.8
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.