Home > Product > Antimicrobial Peptides > Glycocin F

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Glycocin F

[Price Inquiry]
CAT#
AF3006
Sequence
KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC
Host Chemicals
Lactobacillus plantarum KW30
Length
43
Activity
Gram+,
SwissProt ID
PDB ID: 2KUY
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.