Home > Product > Antimicrobial Peptides > Glycocin F

Antimicrobial Peptides

Glycocin F

Price Inquiry
CAT#
AF3006
Sequence
KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC
Host Chemicals
Lactobacillus plantarum KW30
Length
43
Activity
Gram+,
SwissProt ID
PDB ID: 2KUY

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.