Home > Product > Antimicrobial Peptides > Gm anionic pept2

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Gm anionic pept2

[Price Inquiry]
CAT#
AF3332
Sequence
ETESTPDYLKNIQQQLEEYTKNFNTQVQNAFDSDKIKSEVNNFIESLGKILNTEKKEAPK
Host Chemicals
wax moth, Galleria mellonella
Length
60
Activity
Gram+, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.