Home > Product > Catalog Peptides > Others > GMAP (1-41), amide

Others

GMAP (1-41), amide

Price Inquiry
CAT#
G01019
Sequence
ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2
M.W/Mr.
4643.3
Molecular Formula
C206H326N56O64S1
Length
41

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.