Home > Product > Catalog Peptides > Others > GMAP (1-41), amide

Others

GMAP (1-41), amide

[Price Inquiry]
CAT#
G01019
Sequence
ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2
M.W/Mr.
4643.3
Molecular Formula
C206H326N56O64S1
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.