Home > Product > Antimicrobial Peptides > Granulosusin-C1 antimicrobial peptide precursor

Antimicrobial Peptides

Granulosusin-C1 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2546
Sequence
TLKKSLLLLFFLGMISLSLCKQERDANEERRDNPDE
Host Chemicals
Amolops granulosus
Length
36
Activity
Antimicrobial
SwissProt ID
E1AXE3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.