Home > Product > Catalog Peptides > Others > GRF (free acid) (human)

Others

GRF (free acid) (human)

[Price Inquiry]
CAT#
G09009
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
M.W/Mr.
5040.70
Molecular Formula
C215H357N71O67S
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.