CAT# | G09009 |
M.F/Formula | C215H357N71O67S |
M.W/Mr. | 5040.70 |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
Length | 44 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
G09013 | GRF (rat) | Inquiry | ||
G09008 | Growth Hormone Releasing Factor, GRF (1 - 44), amide, human | Inquiry | ||
G09006 | GRF (1-40), human | Inquiry | ||
G09016 | (D-Ala2)-GRF (1-29) amide (human) | Inquiry | ||
G09005 | Growth Hormone Releasing Factor, GRF (1 - 40), amide, human | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...
KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...