Home > Product > Catalog Peptides > Others > GRF (1-40), human

Others

GRF (1-40), human

[Price Inquiry]
CAT#
G09006
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA
M.W/Mr.
4544.1
Molecular Formula
C194H317N61O63S1
Length
40
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.