Home > Product > Catalog Peptides > Others > GRF, mouse

Others

GRF, mouse

Price Inquiry
CAT#
G09007
Sequence
VDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS
M.W/Mr.
5032.9
Molecular Formula
C220H365N69O64S1
Length
41

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.