Home > Product > Catalog Peptides > Others > GRF, mouse

Others

warning All products are for research use only. Not for human use.

GRF, mouse

[Price Inquiry]
CAT#
G09007
Sequence
VDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS
M.W/Mr.
5032.9
Molecular Formula
C220H365N69O64S1
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.