Home > Product > Catalog Peptides > Others > GRF (ovine, caprine)

Others

GRF (ovine, caprine)

Price Inquiry
CAT#
G09011
Sequence
YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
M.W/Mr.
5121.86
Molecular Formula
C221H368N72O66S
Length
44

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.