Home > Product > Catalog Peptides > Others > GRF (ovine, caprine)

Others

GRF (ovine, caprine)

[Price Inquiry]
CAT#
G09011
Sequence
YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
M.W/Mr.
5121.86
Molecular Formula
C221H368N72O66S
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.