Home > Product > Catalog Peptides > Others > GRF (porcine)

Others

GRF (porcine)

[Price Inquiry]
CAT#
G09010
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2
M.W/Mr.
5108.83
Molecular Formula
C219H365N73O66S
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.