Home > Product > Catalog Peptides > Others > GRF (rat)

Others

warning All products are for research use only. Not for human use.
CAT#
G09013
Sequence
HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN
M.W/Mr.
5232.89
Molecular Formula
C225H361N77O66S
Length
43
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.