Keywords Search Google Search Search

GRF (rat)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	G09013
M.F/Formula	C225H361N77O66S
M.W/Mr.	5232.89
Sequence	HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN

CAT#	Product Name	Inquiry
G09006	GRF (1-40), human	Inquiry
G09003	GRF (1-29) amide (rat)	Inquiry
G09010	GRF (porcine)	Inquiry
G09005	Growth Hormone Releasing Factor, GRF (1 - 40), amide, human	Inquiry
G09014	Growth Hormone (6-13), human	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Brief introduction of insulin-like growth factors

IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...

C 21, a selective protein arginine methyltransferase 1 inhibitor

C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...

Aclerastide [DSC127] as a Therapy for the Treatment of Diabetic Foot Ulcers

Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...

Mechanism of Acetyl Tetrapeptide-22

The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...

Medicinal effect of zonisamide for seizures

Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: