Home > Product > Catalog Peptides > Others > Growth Hormone (1-43), human

Others

Growth Hormone (1-43), human

Price Inquiry
CAT#
G09012
Sequence
FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS
M.W/Mr.
5216.2
Molecular Formula
C240H358N62O67S1
Length
43

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.