Home > Product > Catalog Peptides > Others > Growth Hormone (1-43), human

Others

Growth Hormone (1-43), human

[Price Inquiry]
CAT#
G09012
Sequence
FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS
M.W/Mr.
5216.2
Molecular Formula
C240H358N62O67S1
Length
43
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.