Home > Product > Catalog Peptides > Others > GRP78 Binding Chimeric Peptide Motif

Others

GRP78 Binding Chimeric Peptide Motif

[Price Inquiry]
CAT#
A23047
Sequence
WIFPWIQLGGDKDLDADKDLDADKDKDLDADKDLDADK-NH2
M.W/Mr.
2721.5
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.