Home > Product > Catalog Peptides > Others > GRP78 Binding Chimeric Peptide Motif

Others

GRP78 Binding Chimeric Peptide Motif

Price Inquiry
CAT#
A23047
Sequence
WIFPWIQLGGDKDLDADKDLDADKDKDLDADKDLDADK-NH2
M.W/Mr.
2721.5
Length
38

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.