Home > Product > Antimicrobial Peptides > Hadrurin

Antimicrobial Peptides

CAT#
AF2881
Sequence
GILDTIKSIASKVWNSKTVQDLKRKGINWVANKLGVSPQAA
Host Chemicals
Hadrurus aztecus
Length
41
Activity
Antibacterial
SwissProt ID
P82656
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.