Home > Product > Antimicrobial Peptides > Hainanensin-4 antimicrobial peptide precursor

Antimicrobial Peptides

Hainanensin-4 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF3124
Sequence
TTKKSLLLLFFLATINLSLCEEERNAEEKRRDDPDEMNVEMEKR
Host Chemicals
Odorrana hainanensis
Length
44
Activity
Antimicrobial
SwissProt ID
E7EKD3
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.