Home > Product > Antimicrobial Peptides > HbbetaP-1

Antimicrobial Peptides

CAT#
AF2172
Sequence
AANFGPSVFTPEVHETWQKFLNVVVAALGKQYH
Host Chemicals
Ictalurus punctatus
Length
33
Activity
Antiparasitic
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.