Home > Product > Antimicrobial Peptides > HBD-27

Antimicrobial Peptides

CAT#
AF3116
Sequence
QLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC
Host Chemicals
Homo sapiens
Length
44
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.