Home > Product > Antimicrobial Peptides > Heliomicin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Heliomicin

[Price Inquiry]
CAT#
AF3064
Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
Host Chemicals
Heliothis virescens
Length
44
Activity
Antifungal
SwissProt ID
P81544
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.