Home > Product > Antimicrobial Peptides > Heliomicin Mutant

Antimicrobial Peptides

Heliomicin Mutant

[Price Inquiry]
CAT#
AF3065
Sequence
DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET
Host Chemicals
Heliothis virescens
Length
44
Activity
Antibacterial, Antifungal
SwissProt ID
P81544
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.