Home > Product > Catalog Peptides > Others > Helodermin

Others

warning All products are for research use only. Not for human use.

Helodermin

[Price Inquiry]
CAT#
H01001
Sequence
HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2
M.W/Mr.
3843.49
Molecular Formula
C176H285N47O49
Length
35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.