Home > Product > Catalog Peptides > Others > Helodermin

Others

Helodermin

Price Inquiry
CAT#
H01001
Sequence
HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2
M.W/Mr.
3843.49
Molecular Formula
C176H285N47O49
Length
35

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.