Home > Product > Catalog Peptides > Others > Hematopoietic antimicrobial peptide-37

Others

Hematopoietic antimicrobial peptide-37

[Price Inquiry]
CAT#
H16002
Sequence
GWFKKAWRKVKHAGRRVLDTAKGVGRHYLNNWLNRYRG
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.