Home > Product > Catalog Peptides > Others > Hemopexin-like 1

Others

Hemopexin-like 1

[Price Inquiry]
CAT#
M13012
Sequence
FDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPE
Modifications
Disulfide bond(2)
Length
44
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.