Home > Product > Catalog Peptides > Others > Hemopexin-like 3

Others

Hemopexin-like 3

[Price Inquiry]
CAT#
M13014
Sequence
VDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPD
Length
48
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.