Home > Product > Antimicrobial Peptides > Hepcidin 3

Antimicrobial Peptides

Hepcidin 3

[Price Inquiry]
CAT#
AF2891
Sequence
LEEAASNDTPVAAYQEMSMESRMMPDHVRQKRQSHLSMCRW
Host Chemicals
Epinephelus moara
Length
41
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.