Home > Product > Antimicrobial Peptides > Hepcidin 5

Antimicrobial Peptides

Hepcidin 5

Price Inquiry
CAT#
AF2892
Sequence
LEEAASSDTPVAAYQEMSMESRMMPDHVRQKRQSHLSMCRW
Host Chemicals
Epinephelus moara
Length
41
Activity
Antimicrobial
SwissProt ID
F1JYN2

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.