Home > Product > Antimicrobial Peptides > Hepcidin 5

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Hepcidin 5

[Price Inquiry]
CAT#
AF2892
Sequence
LEEAASSDTPVAAYQEMSMESRMMPDHVRQKRQSHLSMCRW
Host Chemicals
Epinephelus moara
Length
41
Activity
Antimicrobial
SwissProt ID
F1JYN2
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.