Home > Product > Antimicrobial Peptides > Hepcidin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2934
Sequence
ETTPEQSNPLALFRSKRQSHLSMCRYCCKCCRNKGCGFCCKF
Host Chemicals
Misgurnus mizolepis
Length
42
Activity
Antibacterial
SwissProt ID
G3KG76
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.