Home > Product > Antimicrobial Peptides > Hepcidin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3048
Sequence
YEEVPVESWKMPYNNRLKRSAAGCKFCCGCCPDMNGCGVCCRF
Host Chemicals
Zanclus cornutus
Length
43
Activity
Antimicrobial
SwissProt ID
J7I5Z4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.