Home > Product > Antimicrobial Peptides > Hepcidin

Antimicrobial Peptides

CAT#
AF3048
Sequence
YEEVPVESWKMPYNNRLKRSAAGCKFCCGCCPDMNGCGVCCRF
Host Chemicals
Zanclus cornutus
Length
43
Activity
Antimicrobial
SwissProt ID
J7I5Z4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.