Home > Product > Antimicrobial Peptides > Hepcidin-like antimicrobial peptide precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Hepcidin-like antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2893
Sequence
LEEAGSNDTPVAAHQEMSTESWMMPNHIRQKRQSHISLCRY
Host Chemicals
Channa argus (snakehead)
Length
41
Activity
Antimicrobial
SwissProt ID
I6ZVM5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.