Home > Product > Antimicrobial Peptides > Hepcidin-like antimicrobial peptide precursor

Antimicrobial Peptides

Hepcidin-like antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF3127
Sequence
YEETSAETWMMPFNIEGEQQSGAIKCRFCCSCCAFGVCGPCCKF
Host Chemicals
Epinephelus coioides
Length
44
Activity
Antimicrobial
SwissProt ID
E2IFI1
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.