Home > Product > Antimicrobial Peptides > HFIAP-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2574
Sequence
GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR
Host Chemicals
Atlantic hagfish, Myxine glutinosa
Length
37
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.