Home > Product > Antimicrobial Peptides > HFIAP-1

Antimicrobial Peptides

CAT#
AF2638
Sequence
GWFKKAWRKVKHAGRRVLDTAKGVGRHYLNNWLNRYR
Host Chemicals
Myxine glutinosa
Length
37
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.