Home > Product > Antimicrobial Peptides > HIMS-Defensin

Antimicrobial Peptides

HIMS-Defensin

[Price Inquiry]
CAT#
AF3241
Sequence
DFGCARGMIFVCMRRCARMYPGSTGYCQGFRCMCDTMIPIRRPPFIMG
Host Chemicals
the tick, Haemaphysalis longicornis
Length
48
Activity
Gram+ & Gram-, Fungi,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.