Home > Product > Antimicrobial Peptides > Hinnavin I

Antimicrobial Peptides

Hinnavin I

[Price Inquiry]
CAT#
AF2832
Sequence
GWKIGKKLEHHGQNIRDGLISAGPAVFAVGQAATIYAAAK
Host Chemicals
Artogeia rapae
Length
40
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.