Home > Product > Antimicrobial Peptides > Hinnavin II

Antimicrobial Peptides

Hinnavin II

[Price Inquiry]
CAT#
AF2727
Sequence
KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG
Host Chemicals
Artogeia rapae
Length
38
Activity
Antibacterial
SwissProt ID
Q68KS5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.