Home > Product > Catalog Peptides > Others > histatherin

Others

histatherin

[Price Inquiry]
CAT#
H20004
Sequence
DSSEEKRHRKRKKHHRGYFQQYQPYQRYPLNYPPAYPFP
Length
39
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.