Home > Product > Catalog Peptides > Others > Histidine-rich basic peptide

Others

warning All products are for research use only. Not for human use.

Histidine-rich basic peptide

[Price Inquiry]
CAT#
A27013
Sequence
QVAQMHIWRAVNHDRHHSTGSGRHSRFLTRNRYRYGGGHLSDA
Modifications
Pyrrolidone carboxylic acid
Length
43
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.