Keywords Search Google Search Search

Histidine-rich basic peptide

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A27013
Sequence	QVAQMHIWRAVNHDRHHSTGSGRHSRFLTRNRYRYGGGHLSDA

CAT#	Product Name	Inquiry
X00486	PH1AP003_08	Inquiry
X05941	PM_1331406	Inquiry
X16935	PM_9803661	Inquiry
X16649	PM_9617582	Inquiry
X01048	PH1BS124_04	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of JIP1 in Promoting Axonal Growth

JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...

What is TB 500?

Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...

Function of Norleual in Pancreatic Cancer

Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...

Broad-spectrum antibacterial activity of PR 39

PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...

Medicinal effect of zonisamide for seizures

Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	43
Modifications	Pyrrolidone carboxylic acid