Home > Product > Catalog Peptides > Others > Histidine-rich basic peptide

Others

Histidine-rich basic peptide

[Price Inquiry]
CAT#
A27018
Sequence
QVAQMHVWRAVNHDRNHGTGSGRHGRFLIRNRYRYGGGHLSDA
Modifications
Pyrrolidone carboxylic acid
Length
43
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.