Home > Product > Antimicrobial Peptides > Human defensin 1

Antimicrobial Peptides

Human defensin 1

[Price Inquiry]
CAT#
AF1861
Sequence
ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Host Chemicals
Homo sapiens
Length
30
Activity
Antibacterial
SwissProt ID
P59665
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.