Home > Product > Antimicrobial Peptides > Human drosomycin-like defensin

Antimicrobial Peptides

Human drosomycin-like defensin

[Price Inquiry]
CAT#
AF2988
Sequence
CLAGRLDKQCTCRRSQPSRRSGHEVGRPSPHCGPSRQCGCHMD
Host Chemicals
Homo sapiens
Length
43
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.