Home > Product > Antimicrobial Peptides > Human KS-30

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Human KS-30

[Price Inquiry]
CAT#
AF1963
Sequence
KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Host Chemicals
Homo sapiens
Length
30
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.