Home > Product > Antimicrobial Peptides > Hyasin

Antimicrobial Peptides

CAT#
AF3159
Sequence
MRLLWLLVAMVVTVLAAATPTAAWQRPLTRPRPFSRPRPYRPNYG
Host Chemicals
Hyas araneus
Length
45
Activity
Antimicrobial
SwissProt ID
A7J1K5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.