Home > Product > Antimicrobial Peptides > Hydramacin-1

Antimicrobial Peptides

Hydramacin-1

[Price Inquiry]
CAT#
AF3337
Sequence
QIVDCWETWSRCTKWSQGGTGTLWKSCNDRCKELGRKRGQCEEKPSRCPLSKKAWTCICY
Host Chemicals
Hydra magnipapillata
Length
60
Activity
Gram+ & Gram-,
SwissProt ID
PDB ID: 2K35
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.