Home > Product > Antimicrobial Peptides > Hyfl C

Antimicrobial Peptides

CAT#
AF2108
Sequence
GSPRQCAETCFIGKCYTEELGCTCTAFLCMKN
Host Chemicals
Hybanthus floribundus E
Length
32
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.