Home > Product > Antimicrobial Peptides > Hyfl I

Antimicrobial Peptides

CAT#
AF1911
Sequence
GIPCGESCVFIPCISGVIGCSCKSKVCYRN
Host Chemicals
Hybanthus floribundus W
Length
30
Activity
Antimicrobial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.